PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000372-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 368aa    MW: 39471.3 Da    PI: 8.4632
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000372-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.21.2e-1084127445
                      S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45 
                      W+ e ++ + +a + ++ +   +W++Ia+ ++ g+t+ ++k+++ 
    NNU_000372-RA  84 WSREQEKAFENALATHPEDsmdRWEKIAASVP-GKTPDEVKHHYE 127
                      ********************************.**********96 PP

2Myb_DNA-binding409.3e-13194238347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
    NNU_000372-RA 194 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVSRTPTQVASHAQKY 238
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.77779134IPR017884SANT domain
SMARTSM007173.3E-980132IPR001005SANT/Myb domain
SuperFamilySSF466899.33E-1182136IPR009057Homeodomain-like
PfamPF002495.4E-984127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-584127IPR009057Homeodomain-like
CDDcd001674.99E-984130No hitNo description
PROSITE profilePS5129417.212186243IPR017930Myb domain
SuperFamilySSF466893.21E-16189244IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-17191241IPR006447Myb domain, plants
SMARTSM007175.5E-10191241IPR001005SANT/Myb domain
PfamPF002491.6E-10194238IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-10194237IPR009057Homeodomain-like
CDDcd001673.06E-9194239No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGILHDNPST SSYVASGCSL LFHCSNPVRT SDAQFLLRRK SLLNSSFLLL LLWEVVYVEG  60
SLSLFSKSKL GLMTTDEEGP SSLWSREQEK AFENALATHP EDSMDRWEKI AASVPGKTPD  120
EVKHHYELLV EDINGIESGR VPLPCYVSSS EGSMDHSNDS GAAKKGSNFG NFQSDSSHGG  180
KSLRSDQERR KGIAWTEDEH RLFLLGLDKY GKGDWRSISR NFVVSRTPTQ VASHAQKYFI  240
RLNSMNKDRR RASIHDITSV GNGDISATQG PITGQTNAPS AGASSGKSNK QPPQPPPGAP  300
GVGVYGTTTI GQPIGGPLVS AVGTPVNLPA PAHMAYGVRP PVPGSVVPGA PVSMAPMTYP  360
MPHASAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1979149676RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010249061.10.0PREDICTED: transcription factor DIVARICATA-like isoform X2
TrEMBLA0A068VFI41e-165A0A068VFI4_COFCA; Uncharacterized protein
STRINGGLYMA07G28310.11e-163(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-101MYB family protein